DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and csnk1a1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_012814233.1 Gene:csnk1a1 / 407897 XenbaseID:XB-GENE-478121 Length:365 Species:Xenopus tropicalis


Alignment Length:342 Identity:187/342 - (54%)
Similarity:239/342 - (69%) Gaps:29/342 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79
            |.||:|||||.||||||||.|.|.:||.||:|:||.|.|||||.||.::|:.|:...|:|.||::
 Frog    15 GKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWY 79

  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            .:|:.|..:||||||||||.||.||.|.||:||||:||:||:.|:||||.:.|:|||||||||||
 Frog    80 GQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLM 144

  Fly   145 GLG------------------TMS----------KQVYLIDFGLSKKYLDITTGVHIPYREERSL 181
            |:|                  |:|          .|::||||||:|||.|..|..||||||:::|
 Frog   145 GIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNL 209

  Fly   182 TGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIE 246
            |||||||||.||.|:|.:|||||.::|||||||||.|||||.|||:||:||||:|.|||:|..:|
 Frog   210 TGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVE 274

  Fly   247 VLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMK-FHNTQK 310
            |||:|||.||.||||||||:.|.:.|:|.::.::||:|...||.:....:||.||..| ......
 Frog   275 VLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAAS 339

  Fly   311 NPGIGMRVFPPKQKEDD 327
            :.|.|.:...|..|:.|
 Frog   340 SSGQGQQAQTPTGKQTD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 171/292 (59%)
SPS1 16..>242 CDD:223589 150/253 (59%)
csnk1a1XP_012814233.1 STKc_CK1_alpha 16..309 CDD:271030 171/292 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.