DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CG12147

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster


Alignment Length:317 Identity:149/317 - (47%)
Similarity:210/317 - (66%) Gaps:21/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYL--GIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIR 77
            |.|:::::||.||||:::.  |:..|  |:||||:|||.|:||.|..|.|||..|:...|:|.::
  Fly    66 GKYRLLKRIGNGSFGELFQAEGLKYH--EKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHVK 128

  Fly    78 YFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNF 142
            ::..|..|..||||||||:||.|...|.|:|::||.|:||:|:|.|||.:|.|.|:|||||||||
  Fly   129 HYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNF 193

  Fly   143 LMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAV 207
            ||||.....|||:|||||:||:..:.|..||.|.|.|.|.|||||||:.||. .|.:||||:.:|
  Fly   194 LMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHY-AEQSRRDDLESV 257

  Fly   208 GYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKP 272
            ||:|:||.||.||||.::|.::.||||:|.|.|.::.::.||.|.|.||.|||.|||.:.|.:||
  Fly   258 GYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKP 322

  Fly   273 NYDFICRMFRML-RNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPKQKEDDG 328
            :|.::.::|::| ||...: ...::||.:|              .|..|.:|.:..|
  Fly   323 DYVYLQQLFKVLFRNQYKV-CDFLFDWVVL--------------KRESPEQQSQQKG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/266 (52%)
SPS1 16..>242 CDD:223589 121/227 (53%)
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 137/266 (52%)
SPS1 67..>306 CDD:223589 125/241 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.