DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and vrk2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_957464.2 Gene:vrk2 / 394145 ZFINID:ZDB-GENE-040426-1046 Length:574 Species:Danio rerio


Alignment Length:366 Identity:105/366 - (28%)
Similarity:165/366 - (45%) Gaps:52/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSSQNREVRIGNYKVVRKIGCGSFGDIYL-----GIYIHSGERVAIKVESSKVRHPQLNYERRI 63
            |..|:.:..|||     :.||.|.||.|||     .:.:.......||||..:  :..|..|.:.
Zfish    18 LTDSEKKNWRIG-----KMIGKGGFGLIYLASQDVNVPVRDDADFVIKVEYHE--NGPLFSELKF 75

  Fly    64 Y-RALRPAH-------------GLPRIRYF------HKEEHYQAMVMDLLGPSLERLFQFCERAF 108
            | ||.:|..             |:|  .|:      .....|:.||||.||..|:::........
Zfish    76 YQRAAKPETMSKWMKSKQLGFLGIP--TYWGSGLTESNGTRYRFMVMDRLGTDLQKVLIDNGGQL 138

  Fly   109 TIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHI 173
            ...:||.|...||..:||:|:..::|.|||..|.|:|....:| |||.|:|||.:|  ...|.|.
Zfish   139 RKTSVLQLGVLMLDVLEYIHDNEYVHADIKAANLLLGYRDPNK-VYLADYGLSYRY--CPNGEHK 200

  Fly   174 PYRE--ERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPW-QDLK--ASTKQQKY 233
            .|:|  ::...||..|.||.||.||.::||.|:..:||.|:::..|:||| ..||  |..::.|.
Zfish   201 EYKENPKKGHNGTIEYTSIDAHKGVAASRRGDLKVLGYCLLHWQCGTLPWLPSLKNPAEVQEAKA 265

  Fly   234 ERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDW 298
            :.:.....|| :::.......|...:|:..:.:|:.:||:|    :..||:.:...|:..|    
Zfish   266 KLMSNLPDSV-LKMSTSSSSMEIAQFLSRVKDLGYNEKPDY----QALRMVLSATGLQGPL---- 321

  Fly   299 DMLMMKFHNTQKNPGIGMRVFPPKQKEDDGISGEPIIKDEK 339
            |:...:...|.: |........||..|......:|.:..|:
Zfish   322 DLSRQRASETVR-PTTQRAASQPKTTEKKMGRSKPAVTAEE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 88/294 (30%)
SPS1 16..>242 CDD:223589 80/255 (31%)
vrk2NP_957464.2 STKc_VRK2 13..313 CDD:271025 95/311 (31%)
SPS1 25..406 CDD:223589 103/359 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.