DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Vrk3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001005561.2 Gene:Vrk3 / 361565 RGDID:1549692 Length:462 Species:Rattus norvegicus


Alignment Length:282 Identity:70/282 - (24%)
Similarity:129/282 - (45%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RVAIKVESSKVR-HPQLNYERRI----------YRALRPAHGLPR-IRYFHKEEHYQAMVMDLLG 94
            |.::|::|...| ..:.|:.:|.          .|.|.|...:|. |.:...::.|:.:|...||
  Rat   187 RFSLKLDSKDGRLFNEQNFFQRAAKPLQVNKWKKRCLTPLLAIPTCIGFGVHQDKYRFLVFPSLG 251

  Fly    95 PSLE-RLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDF 158
            .||: .|....:...:.:.:|.:|.::|..:||:|...::|.::..:|..:....:| ||.|:.:
  Rat   252 RSLQSALDDNPKHVVSERCMLQVACRLLDALEYLHEHEYVHGNLTTENVFVNPEDLS-QVTLVGY 315

  Fly   159 GLSKKYLDITTGVHIPYRE-ERSL-TGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPW 221
            |.:.:|  ...|.|:.|:| .||| .|...:.|:..|.|...:||.|:..:||.::.:..|||||
  Rat   316 GFTYRY--CPGGKHVAYKEGSRSLHDGDLEFISMDVHKGCGPSRRSDLQTLGYCMLKWLYGSLPW 378

  Fly   222 QDLKASTKQ-----QKYERIHEKKISV------SIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYD 275
            .:...:|::     |||:...|..:.:      :.|.|.|        ||.....:.:.:||.|.
  Rat   379 TNCLPNTEEITKQKQKYQDNPEPLVGLCGRWNKTSETLRE--------YLKVVMALDYEEKPPYA 435

  Fly   276 FICRMFRMLRNGLNLRPGLIYD 297
            .:.....:|...:.:.|   ||
  Rat   436 TLRNNLEVLLQNMRVSP---YD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 66/264 (25%)
SPS1 16..>242 CDD:223589 58/219 (26%)
Vrk3NP_001005561.2 zinc_ribbon_2 13..35 CDD:289981
DZR 14..>38 CDD:289539
PKc_like 143..445 CDD:304357 66/268 (25%)
SPS1 229..>458 CDD:223589 61/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.