DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Vrk2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:346 Identity:103/346 - (29%)
Similarity:160/346 - (46%) Gaps:62/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GN-YKVVRKIGCGSFGDIYLGIYIHSGERVA---IKVESSKVRHPQLNYERRIYRALRPAH---- 71
            || :.:.:.||.|.||.|||....:..|:.|   ||||..:  :..|..|.:.|:  |.|.    
  Rat    26 GNQWALGKMIGSGGFGLIYLAFPTNKPEKDARHVIKVEYQE--NGPLFSELKFYQ--RAAKRECI 86

  Fly    72 ------------GLPRIRYF----HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQM 120
                        |:|....|    .|...|:.|||:.||..|::|.. ...||...|||.|..:|
  Rat    87 QKWVKQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLN-QNGAFKKLTVLQLGIRM 150

  Fly   121 LRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREE--RSLTG 183
            |..:||:|...::|.|||..|.|:|.....: |||.|:|||.:|  ...|.|..|.|:  :...|
  Rat   151 LDVLEYIHENEYVHGDIKAANLLLGYANPDR-VYLADYGLSYRY--CPNGNHKQYHEDPRKGHNG 212

  Fly   184 TARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQ---DLKASTKQQKYERIHEKKISVSI 245
            |..:.|:.||.||..:||.|:..:||.::.:..|.|||:   :...:.:..|.:.:.|...|| :
  Rat   213 TLEFTSLDAHKGVAPSRRSDVEILGYCMLRWLCGKLPWETNLENPVAVQTAKTKLLDELPESV-L 276

  Fly   246 EVLCEGFPC----EFTMYLNYCRGMGFYDKPNYDFICRMFRMLR-NGLNLRPGLIYDWDMLMMKF 305
            :....|..|    ||.||::   .:.:..||:|.   ::.::|. :|:.|.|          :.|
  Rat   277 KWTTSGSSCRELAEFFMYVH---NLAYDAKPDYQ---KLKKILNPDGVPLGP----------LDF 325

  Fly   306 HNTQKNPGIGMRVFPPKQKED 326
              :.|..|:.|:. |..:|.|
  Rat   326 --STKAQGVNMQT-PIHRKVD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 91/297 (31%)
SPS1 16..>242 CDD:223589 80/254 (31%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 92/302 (30%)
Pkinase 29..290 CDD:278497 83/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.