DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CG5790

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster


Alignment Length:235 Identity:54/235 - (22%)
Similarity:85/235 - (36%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERLRSSQNREVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVR-----HPQLNYE 60
            |.|:..|.....|.. :.|..:||.|:|..:.||..    :|....||:.:.|     |...|:.
  Fly   129 EALKELQESIPEINKIFDVHCRIGSGTFSTVLLGTL----QRERGLVETQRRRFAIKHHNPTNHP 189

  Fly    61 RRIYRALRPAH---GLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLR 122
            .||.|.|...:   |:..:...:....|...|..::.......|....|:.....:......:|.
  Fly   190 ERILRELECMYRIGGVENVIGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLI 254

  Fly   123 RVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLD---ITTGVHIPYRE------- 177
            .:.:||....:|||:||.|.|....|  .:..|.||||:::..|   :.....:..||       
  Fly   255 ALRHVHKFNVIHRDVKPSNILYNRRT--GKFLLCDFGLAQRIADDGSVVQSSDLSSREVFSILRD 317

  Fly   178 ---ERSLTGT---------------ARYASIGAHAGVESA 199
               .||:|.|               .|..::|....||.|
  Fly   318 LENGRSVTLTDGNSAQAEAEDYMARRRMRALGGGGSVERA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 50/221 (23%)
SPS1 16..>242 CDD:223589 50/221 (23%)
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 50/221 (23%)
S_TKc 145..597 CDD:214567 50/219 (23%)
PKc_like <238..>363 CDD:304357 29/122 (24%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.