DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CG9962

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster


Alignment Length:303 Identity:140/303 - (46%)
Similarity:187/303 - (61%) Gaps:9/303 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRI 76
            :||.:..|:||:|.|||||||...::.||..||:|||........|:.|..:|..||...|:|..
  Fly    10 LRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMT 74

  Fly    77 RYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDN 141
            ..|.....:..:||:|||||||.||..|.|.|::||||:||:||:.|:||:|...::||||||:|
  Fly    75 YQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPEN 139

  Fly   142 FLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVA 206
            ||||:|....:::||||||||:|.|:....|:|.|......|||||||:.|......:||||:.:
  Fly   140 FLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLES 204

  Fly   207 VGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDK 271
            |||||:|..|||||||.|..::|.||.|.|.|.|:|.....||.|:|.||..|:.|.|.:||.::
  Fly   205 VGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEE 269

  Fly   272 PNYDFI-CRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNPG 313
            |:|..| |....:|.| |.....||||||       :.:||.|
  Fly   270 PDYRMIRCTFLSLLFN-LKFTNDLIYDWD-------HAEKNSG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 126/265 (48%)
SPS1 16..>242 CDD:223589 110/225 (49%)
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 118/242 (49%)
STKc_CK1 17..279 CDD:270918 126/261 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.