DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Cdc7

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster


Alignment Length:189 Identity:47/189 - (24%)
Similarity:76/189 - (40%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSG-------ERVAIKVESSKVRHPQLNYERRIYRALR---PAH 71
            :.|..:||.|:|..:.||......       .:.|||      .|...::..||.:.|:   ...
  Fly   127 FDVHSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIK------HHIPTSHPDRIMKELQCMTKMG 185

  Fly    72 GLPRIRYFHKEEHYQ---AMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFL 133
            |...:...|....|.   |.||..:  :.:|...|..| ..:..:......:|..:.:||....:
  Fly   186 GKENVVGIHCCMRYDASAAFVMPFM--AHDRFQDFYTR-MDVPEIRQYMRNLLVALRHVHKFDVI 247

  Fly   134 HRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGA 192
            |||:||.|||  .....::..|:||||::         |:.....|| :|:|  |:|.|
  Fly   248 HRDVKPSNFL--YNRRRREFLLVDFGLAQ---------HVNPPAARS-SGSA--AAIAA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 47/189 (25%)
SPS1 16..>242 CDD:223589 47/189 (25%)
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 47/189 (25%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.