DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and hhp2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_593184.1 Gene:hhp2 / 2541929 PomBaseID:SPAC23C4.12 Length:400 Species:Schizosaccharomyces pombe


Alignment Length:315 Identity:168/315 - (53%)
Similarity:221/315 - (70%) Gaps:9/315 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLP 74
            :::||| |::.||||.||||.||||:...:||:||:|:|..|.||.||.||.|:|..|:...|:|
pombe     5 DIKIGNKYRIGRKIGSGSFGQIYLGLNTVNGEQVAVKLEPLKARHHQLEYEFRVYNILKGNIGIP 69

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .||:|.....|.||||||||||||.||.:|.|.||:|||||||:|::.|:||||::.||||||||
pombe    70 TIRWFGVTNSYNAMVMDLLGPSLEDLFCYCGRKFTLKTVLLLADQLISRIEYVHSKSFLHRDIKP 134

  Fly   140 DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDM 204
            |||||  ...|..|.:|||||:|||.|..|.||||||:.::||||||||||..|.|:|.:||||:
pombe   135 DNFLM--KKHSNVVTMIDFGLAKKYRDFKTHVHIPYRDNKNLTGTARYASINTHIGIEQSRRDDL 197

  Fly   205 VAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFY 269
            .::||||:||.|||||||.|:|.||:|||:||.:.||...:||||:|.|.||..|:.|.|.:.|.
pombe   198 ESLGYVLLYFCRGSLPWQGLQADTKEQKYQRIRDTKIGTPLEVLCKGLPEEFITYMCYTRQLSFT 262

  Fly   270 DKPNYDFICRMFRMLRNGLNLRPGLIYDW--DMLMMKFHNTQKNPGIGMRVFPPK 322
            :||||.::.::||    .|.:|.|..||:  |.:::|:..............||:
pombe   263 EKPNYAYLRKLFR----DLLIRKGYQYDYVFDWMILKYQKRAAAAAAASATAPPQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 155/265 (58%)
SPS1 16..>242 CDD:223589 138/226 (61%)
hhp2NP_593184.1 SPS1 11..353 CDD:223589 165/309 (53%)
PKc_like 11..283 CDD:304357 158/277 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.