DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and hhp1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_595760.1 Gene:hhp1 / 2540718 PomBaseID:SPBC3H7.15 Length:365 Species:Schizosaccharomyces pombe


Alignment Length:349 Identity:186/349 - (53%)
Similarity:242/349 - (69%) Gaps:22/349 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLP 74
            ::|||| |::.||||.|||||||||..:.|||.||||:||::.:||||.||.|:||.|....|:|
pombe     4 DLRIGNKYRIGRKIGSGSFGDIYLGTNVVSGEEVAIKLESTRAKHPQLEYEYRVYRILSGGVGIP 68

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .:|:|..|..|.||||||||||||.||.||.|.|::|||||||:|::.|:|::|::.||||||||
pombe    69 FVRWFGVECDYNAMVMDLLGPSLEDLFNFCNRKFSLKTVLLLADQLISRIEFIHSKSFLHRDIKP 133

  Fly   140 DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDM 204
            ||||||:|....||.:|||||:|||.|..|.:||||||.::||||||||||..|.|:|.:||||:
pombe   134 DNFLMGIGKRGNQVNIIDFGLAKKYRDHKTHLHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 198

  Fly   205 VAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFY 269
            .::||||:||.|||||||.|||:||:||||:|.|||||...||||.|||.||::||||.|.:.|.
pombe   199 ESLGYVLVYFCRGSLPWQGLKATTKKQKYEKIMEKKISTPTEVLCRGFPQEFSIYLNYTRSLRFD 263

  Fly   270 DKPNYDFICRMFRMLRNGLNLRPGLIYDWDM-------------LMMKFHNTQK--NPGIGMRVF 319
            |||:|.::.::||.|....:.....::||.:             |..:...|.:  ||......|
pombe   264 DKPDYAYLRKLFRDLFCRQSYEFDYMFDWTLKRKTQQDQQHQQQLQQQLSATPQAINPPPERSSF 328

  Fly   320 PPKQKED-DGISGE-----PIIKD 337
            ...||:: |...|:     |:|.|
pombe   329 RNYQKQNFDEKGGDINTTVPVIND 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 166/265 (63%)
SPS1 16..>242 CDD:223589 145/226 (64%)
hhp1NP_595760.1 SPS1 10..335 CDD:223589 177/324 (55%)
STKc_CK1_delta_epsilon 10..284 CDD:271027 168/273 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.