DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and cki1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001342877.1 Gene:cki1 / 2539610 PomBaseID:SPBC1347.06c Length:446 Species:Schizosaccharomyces pombe


Alignment Length:324 Identity:146/324 - (45%)
Similarity:202/324 - (62%) Gaps:12/324 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPA 70
            |.||..|.: :|||.|:||.||||.|:.|..:.:.::||||.|..:...|||..|.|.|:.|...
pombe     2 SGQNNVVGV-HYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRSDAPQLRDEYRTYKLLAGC 65

  Fly    71 HGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHR 135
            .|:|.:.||.:|..:..:|:||||||||.|...|.|.|::|||.:.|:|||.||:.:|.:..::|
pombe    66 TGIPNVYYFGQEGLHNILVIDLLGPSLEDLLDLCGRKFSVKTVAMAAKQMLARVQSIHEKSLVYR 130

  Fly   136 DIKPDNFLMGL--GTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVES 198
            ||||||||:|.  ...:..:|::|||:.|.|.|..|..||||||:::|:|||||.||..|.|.|.
pombe   131 DIKPDNFLIGRPNSKNANMIYVVDFGMVKFYRDPVTKQHIPYREKKNLSGTARYMSINTHLGREQ 195

  Fly   199 ARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYC 263
            :||||:.|:|:|.|||.|||||||.|||:|.:||||||.|||.|..:..||.|||.||..|::|.
pombe   196 SRRDDLEALGHVFMYFLRGSLPWQGLKAATNKQKYERIGEKKQSTPLRELCAGFPEEFYKYMHYA 260

  Fly   264 RGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPKQKEDD 327
            |.:.|...|:||::..:|..:...||......:||::|         |.|.|.:....:..|.:
pombe   261 RNLAFDATPDYDYLQGLFSKVLERLNTTEDENFDWNLL---------NNGKGWQSLKSRNAETE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 132/266 (50%)
SPS1 16..>242 CDD:223589 117/227 (52%)
cki1NP_001342877.1 STKc_CK1_fungal 11..287 CDD:271029 134/275 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.