DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Vrk1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001351296.1 Gene:Vrk1 / 22367 MGIID:1261847 Length:440 Species:Mus musculus


Alignment Length:378 Identity:104/378 - (27%)
Similarity:168/378 - (44%) Gaps:66/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIY-----IHSGERVAIKVESSKVRHPQLNYER 61
            |.|.....:|.::|     ..||.|.||.|||...     :.|.....:|||.|.  :..|..|.
Mouse    27 EVLTDMSRKEWKLG-----LPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSD--NGPLFTEL 84

  Fly    62 RIY-RALRPAH-------------GLPRIRYFHKEEH------YQAMVMDLLGPSLERLFQFCER 106
            :.| ||.:|..             |:|  :|:....|      |:.|:||..|..|:::::...:
Mouse    85 KFYQRAAKPEQIQKWIRTHKLKYLGVP--KYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAK 147

  Fly   107 AFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGV 171
            .|:.||||.|:.::|..:||:|...::|.|||..|.|:. .....||||:|:||:.:|  ...||
Mouse   148 RFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLS-HKNPDQVYLVDYGLAYRY--CPDGV 209

  Fly   172 HIPYREE--RSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYE 234
            |..|:|:  |...||..:.||.||.||..:||.|:..:||.::.:..|.|||:|   :.|...|.
Mouse   210 HKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWED---NLKDPNYV 271

  Fly   235 RIHEKKISVSIEVLCE------GFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPG 293
            |..:.:...::..|.|      ..|.|...|:...:.:.:.:||.|.             |||..
Mouse   272 RDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQ-------------NLRDI 323

  Fly   294 LIYDWDMLMMK-----FHNTQKNPGIGMRVFPPKQKEDDGISGEPIIKDEKCN 341
            |:.....:..|     ..:..:|..:..|....|:|::...|....::|.:|:
Mouse   324 LLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 88/297 (30%)
SPS1 16..>242 CDD:223589 80/252 (32%)
Vrk1NP_001351296.1 STKc_VRK1 26..326 CDD:271024 96/326 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.