DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1g1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_006511071.1 Gene:Csnk1g1 / 214897 MGIID:2660884 Length:467 Species:Mus musculus


Alignment Length:299 Identity:146/299 - (48%)
Similarity:207/299 - (69%) Gaps:8/299 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVRIG-NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRP 69
            |:.:..:.:| |::|.:|||||:||::.||..:::.|.||||:|..|.|.|||:.|.|.|:.|..
Mouse    32 STSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGS 96

  Fly    70 A-HGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFL 133
            | .|||::.||.....|.|||::|||||||.||..|:|.||:||||::|.|:|.|:||||::..:
Mouse    97 AGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLI 161

  Fly   134 HRDIKPDNFLMGLGTMSKQ--VYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGV 196
            :||:||:|||:|.....|:  :::|||||:|:|:|..|..||||||.:||||||||.||..|.|.
Mouse   162 YRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGK 226

  Fly   197 ESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLN 261
            |.:||||:.|:|::.|||.|||||||.|||.|.:::|::|.:.|.:..||.|||.||.|...||.
Mouse   227 EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLR 291

  Fly   262 YCRGMGFYDKPNYDFICRMFRML--RNGLNLRPGLIYDW 298
            |.|.:.|::||:|:::..:|..|  |.|...  ...|||
Mouse   292 YVRRLDFFEKPDYEYLRTLFTDLFERKGYTF--DYAYDW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/267 (51%)
SPS1 16..>242 CDD:223589 121/228 (53%)
Csnk1g1XP_006511071.1 STKc_CK1_gamma 43..331 CDD:271028 144/288 (50%)
CK1gamma_C 331..429 CDD:403712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.