DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ZK666.8

DIOPT Version :10

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_496261.2 Gene:ZK666.8 / 191385 WormBaseID:WBGene00014048 Length:391 Species:Caenorhabditis elegans


Alignment Length:82 Identity:21/82 - (25%)
Similarity:34/82 - (41%) Gaps:23/82 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 INDTVDFWQHDKITGDIQTRRLKLWEDSFEELLADSLGRETLQKFLDKEYSGENLRFWWEVQKLR 458
            |.|.||.|:|.|        ..:.|.|.:|:   |.      .:|.....:.:||:   ..:|.|
 Worm   372 ILDKVDKWRHAK--------EEETWLDDYEK---DE------NRFSAVRGAHKNLK---RAEKAR 416

  Fly   459 KCSSR---MVPVMVTEI 472
            ...|:   ||.|:.|::
 Worm   417 SLISKIPAMVDVLTTKV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918
ZK666.8NP_496261.2 Protein Kinases, catalytic domain 92..354 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.