DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ZC581.2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_491912.3 Gene:ZC581.2 / 191200 WormBaseID:WBGene00022632 Length:342 Species:Caenorhabditis elegans


Alignment Length:319 Identity:87/319 - (27%)
Similarity:140/319 - (43%) Gaps:59/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVE----SSKVRHPQLNYERRIYRALRP 69
            |.::..|.:.|...||.|.||.||.|......|.|.||:|    ..:.|...:..::.:||    
 Worm    40 NDQMFRGKFMVKGLIGRGGFGQIYYGSDATFPEDVVIKIEPVVLKGRPRRRMILEQKVLYR---- 100

  Fly    70 AHGLPRIRYFHKEEHYQAM---VMDLLGPSL---------ERLFQFCERAFTIKTVLLLAEQMLR 122
            ..|.|.:.......|.:.:   ||.||||::         :||.|        .||..:..|.:.
 Worm   101 LQGRPHVPIMCASGHTEQLNFIVMQLLGPNIGDLKKRSPVKRLSQ--------TTVARIMIQGIA 157

  Fly   123 RVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVY-LIDFGLSKKYLDITTGVHIPYREERSLTGTAR 186
            .:..||:.|::|||:||.|...|:...::.|. |:|:|:.:::.:: .|.....|.:....||.|
 Worm   158 ALRDVHSLGYIHRDVKPANMCFGVTQSTRHVLKLVDYGMVRRFKNV-DGTRRKQRYKPGFRGTLR 221

  Fly   187 YASIGAHAGVESARRDDMVAVGY---VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISV----S 244
            |:|:..|.|.|....||.|::.|   .|:..|   |||       |....:.|.:.|:..    |
 Worm   222 YSSVRVHDGKEQTPVDDFVSMAYSGAELLLVN---LPW-------KLVSTDDIRQTKVDFNTPNS 276

  Fly   245 IEVLCEGFPCEFTMYLNYCRGMGFYDKPNY----DFICRMFRMLRNGLNLRPGLIYDWD 299
            ..:|..| | .|:::......:...|:|::    :.:|.|.|    |.:||..  ||||
 Worm   277 PYLLLTG-P-YFSVFCGAIFNLRSEDEPDHSSLQNLLCDMTR----GKSLREA--YDWD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 76/292 (26%)
SPS1 16..>242 CDD:223589 68/245 (28%)
ZC581.2NP_491912.3 PKc_like 47..311 CDD:389743 75/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.