DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and W06F12.3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_499835.1 Gene:W06F12.3 / 189253 WormBaseID:WBGene00012307 Length:318 Species:Caenorhabditis elegans


Alignment Length:299 Identity:78/299 - (26%)
Similarity:137/299 - (45%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHK 81
            ::|.:.:|.|.||.|:..:.:.:...||:|||...|...::..|..|...|..:..:|::.|..:
 Worm    38 FQVEKMVGGGGFGQIFRAVDMETKLVVAVKVEPKSVESGRIVLELHILVELAHSPHIPKVHYSGE 102

  Fly    82 EEHYQAMVMDLLGPSLERLFQFCE-RAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMG 145
            ...|..:||.|||.::..|.:|.: |.|:.:|...:..|.|..::.:|..|::||||||.|..:|
 Worm   103 IGGYNFIVMQLLGSNITDLRKFQKGRCFSAETTARVGIQCLEGLKQIHELGYIHRDIKPSNICVG 167

  Fly   146 LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYV 210
            :|...:.:|::|||:::: :...:|...|.|...|..||.||.|:.||...|....||:..:.:.
 Worm   168 IGEHKRVLYIVDFGMARQ-IRFPSGAFRPERPYASFRGTTRYVSLAAHERKEQGFADDIWCLFFS 231

  Fly   211 LMYFNRGSLPW-----QDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYD 270
            |:....| |||     ||.....||........:|:..:...    ||....:...       .:
 Worm   232 LLELAEG-LPWKNVVDQDQVYHAKQLLLRNFQSRKMGQNFGT----FPRALELIKR-------TE 284

  Fly   271 KPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQ 309
            .|||:....:.:...:.:|       :|:......|:.|
 Worm   285 TPNYENFIVILKSCSSRVN-------EWEEFEWDDHDEQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 74/269 (28%)
SPS1 16..>242 CDD:223589 69/230 (30%)
W06F12.3NP_499835.1 PKc_like 38..289 CDD:389743 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.