DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and T05C12.1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_495715.1 Gene:T05C12.1 / 188121 WormBaseID:WBGene00011466 Length:325 Species:Caenorhabditis elegans


Alignment Length:304 Identity:78/304 - (25%)
Similarity:141/304 - (46%) Gaps:28/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 REVRIGN---YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQ-LNYERRIYRALRPA 70
            ||..:|.   :.|.:.|..|.||.:|......:.|.||:|||.:.....| :..|.::...:..:
 Worm    36 RETCLGRNDIFVVEKMIAGGGFGQVYRARNTETQEEVAVKVERATTNDSQRMILESKVLDDMLGS 100

  Fly    71 HGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFC-ERAFTIKTVLLLAEQMLRRVEYVHNRGFLH 134
            ...|.:.|......|..:||.:||.::..:.:.. .:..:|.:.:.:..|::..:..:|::|:||
 Worm   101 KHFPNVYYIGPYHSYNFIVMQMLGKNIGDIRKMMPNKKISILSSVRIGIQIIEALSLLHSKGWLH 165

  Fly   135 RDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERS---LTGTARYASIGAHAGV 196
            ||:||.|..:||....|.|||:|||:|:|:.:....:    ||.|:   ..||.||.|...|...
 Worm   166 RDLKPTNCCLGLDEKRKTVYLVDFGMSRKFRNDNGSL----RESRTYCGFRGTTRYCSYRMHDRR 226

  Fly   197 ESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLN 261
            |....||:..:.|.|.....|.|||:|::::.     |..|.||| :..|.:....|.:|..:..
 Worm   227 EQGPVDDLWCLYYSLGELIEGCLPWRDIESAD-----EMAHVKKI-LKHEDIFHSMPSKFASFGR 285

  Fly   262 YCRGMGFYDKPNY----DFICRMFRMLRNGLNLRPGLIYDWDML 301
            ..|.:...:.|:|    :.:....:.:.:...      ::||::
 Worm   286 NLRRLRPANTPDYTKFQNILAYCVKFVDDNAE------FEWDVM 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 73/276 (26%)
SPS1 16..>242 CDD:223589 66/233 (28%)
T05C12.1NP_495715.1 PKc_like 46..305 CDD:389743 73/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S280
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.