DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and F54H5.2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_495347.1 Gene:F54H5.2 / 186263 WormBaseID:WBGene00018839 Length:424 Species:Caenorhabditis elegans


Alignment Length:302 Identity:85/302 - (28%)
Similarity:150/302 - (49%) Gaps:32/302 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHP-QLNYERRIYRALRPAHGLPRIRYF 79
            :::|:||:|.|..|.:||...:......|:|.||:..... .|..|..|   |:...|.|.:..|
 Worm    30 SWQVIRKLGEGGCGSVYLVKNLEDETEAAMKAESNGAAGGCVLKLEVAI---LKKLSGKPHVCQF 91

  Fly    80 ---HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDN 141
               .:...:..::|.|||.||.::.:...|..|:.:.:.:|..:|..::.:|:.||:|||:||.|
 Worm    92 LFAARLTDFTYVIMTLLGESLNKIVKRIARQITVSSQVRIAANVLFCLKQIHDIGFIHRDLKPAN 156

  Fly   142 FLMGLGTMSKQ---VYLIDFGLSKKYL----DITTGVHIPYREERSL-TGTARYASIGAHAGVES 198
            ..:|..|.:.:   .:::||||:::::    |..:.:.:....|||| .||.||.||..|...|.
 Worm   157 MALGYKTNNDECRFFHVLDFGLARQFVVSQSDQPSKLMMRRPRERSLFRGTTRYCSIRMHDRAEQ 221

  Fly   199 ARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYC 263
            .|.||:.::.|:|... ||.|||..........:.:|:|      |.||:.:..|.||.....|.
 Worm   222 GRVDDLWSILYLLAEL-RGPLPWSSQNDKRVVGEMKRLH------SDEVVLQNSPMEFLEIAKYL 279

  Fly   264 RGMGFYDKPNYDFICRMFRMLRNGLNLRPGLI-----YDWDM 300
            |.:.::.:|:|.   ::|.:|.:.::  .|..     :||:|
 Worm   280 RSLTYFHRPDYH---KIFMLLISIMS--KGKFSWNDPFDWEM 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 79/276 (29%)
SPS1 16..>242 CDD:223589 69/237 (29%)
F54H5.2NP_495347.1 PKc_like 31..297 CDD:389743 80/278 (29%)
rplD 317..>422 CDD:184900 85/302 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.