DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and F16B12.7

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_510350.2 Gene:F16B12.7 / 184566 WormBaseID:WBGene00008883 Length:301 Species:Caenorhabditis elegans


Alignment Length:281 Identity:66/281 - (23%)
Similarity:105/281 - (37%) Gaps:79/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRY 78
            :..|.|...||.||:|.|   :.::..|              :||.| ::.:.::..||..|.:.
 Worm     9 VKEYYVSYLIGEGSYGSI---VAVNDME--------------ELNKE-KVIKLVKFVHGSQREKS 55

  Fly    79 FHKEEHYQAMVMDLLGPSLERLF-QFCER----------------------------AFTIKTVL 114
            | |.|......:|.||.|....| ||||.                            .|..|.|.
 Worm    56 F-KTELSVFRKLDSLGNSKRNGFPQFCENFQVDGYYAIVLSDEGDNLNDIRKRNKNLVFNRKNVA 119

  Fly   115 LLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSK--QVYLIDFGLSKKY--------LDITT 169
            .:...:.|.:..:|:.||.|.|:...|.::.: .:.|  .:.||||||||::        :|.|.
 Worm   120 TVGCAVSRSLSTLHSIGFFHADLHEQNLMVPV-PIDKINPIKLIDFGLSKRFKTRKRRNCIDKTY 183

  Fly   170 GVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKAST-KQQKY 233
            .|         |....|..|.....|.:..:.||..::.|:|:.         ||..|. ::.|.
 Worm   184 KV---------LLADERRCSFNIACGGDYRKSDDFESLFYILLI---------DLGLSCYRENKA 230

  Fly   234 ERIHEK-KISVSIEVLCEGFP 253
            :|...| |:..:.|...:..|
 Worm   231 QRFLTKLKLHFATETFLQNLP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 66/279 (24%)
SPS1 16..>242 CDD:223589 64/266 (24%)
F16B12.7NP_510350.2 PKc_like 12..284 CDD:389743 66/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.