DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C55B7.10

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_491873.4 Gene:C55B7.10 / 183845 WormBaseID:WBGene00016946 Length:369 Species:Caenorhabditis elegans


Alignment Length:292 Identity:89/292 - (30%)
Similarity:142/292 - (48%) Gaps:20/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPA---HGLPRIRY 78
            ||:...:|.|.:|.::|.    ..:.:.|.|::.|....||..|..:.:|...|   |....:..
 Worm    61 YKLGPVLGDGGYGTVFLS----QDDDIKIAVKTEKFSKSQLKIEIVVLKAAMQANCKHFCELVDC 121

  Fly    79 FHKEEHYQAMVMDLLGPSLERLFQFCE---RAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPD 140
            ..|.:.:..|::.|||..|.:|  .||   |.|:|.|.|.:..|.|:..|.:|..||:.||:||.
 Worm   122 GTKGKDFDYMMITLLGKDLHKL--RCELPGRKFSINTALRIGIQTLKACEELHRIGFVSRDVKPG 184

  Fly   141 NFLMGL--GTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDD 203
            ||..|:  ...|:.:::.||||::||:|....| ||.|:|....||.||.|:.||..::..||||
 Worm   185 NFAPGVKSNRQSRTIFMYDFGLARKYIDKNNQV-IPTRKEVGWRGTTRYGSLNAHKRLDLGRRDD 248

  Fly   204 MVAVGYVLMYFNRGSLPWQD-LKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMG 267
            :.:..|.|:...||:|||:: :..|:.|:..|..|.   :...:.|.| .|.::...........
 Worm   249 LESWFYGLVEMTRGTLPWRNVVDRSSVQRAKEASHN---TGRTQFLFE-TPSQYDKIFTIVDSYA 309

  Fly   268 FYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            |...|:|..|.::....|....||....:||:
 Worm   310 FESAPDYKQINKLLVEAREERQLRDREHWDWE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 84/272 (31%)
SPS1 16..>242 CDD:223589 77/233 (33%)
C55B7.10NP_491873.4 PKc_like 60..323 CDD:389743 84/272 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.