powered by:
Protein Alignment CG2577 and C55B6.5
DIOPT Version :9
Sequence 1: | NP_572794.1 |
Gene: | CG2577 / 32188 |
FlyBaseID: | FBgn0030384 |
Length: | 344 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509211.2 |
Gene: | C55B6.5 / 183840 |
WormBaseID: | WBGene00016941 |
Length: | 102 |
Species: | Caenorhabditis elegans |
Alignment Length: | 31 |
Identity: | 10/31 - (32%) |
Similarity: | 15/31 - (48%) |
Gaps: | 8/31 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 ERLRSSQNREVRIGNYKVVRKIGCGSFGDIY 32
:||.:.| ||:..|||.|..|.::
Worm 8 DRLLAKQ--------YKLTTKIGAGDVGQVW 30
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1164 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.