DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C14A4.13

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_496292.1 Gene:C14A4.13 / 182582 WormBaseID:WBGene00007563 Length:471 Species:Caenorhabditis elegans


Alignment Length:357 Identity:90/357 - (25%)
Similarity:156/357 - (43%) Gaps:45/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHS-GERVAIKVESSKVRHPQLNYERRIYRAL---RPAHGLPR 75
            |.:..|:.||.|::|.:|..:..:| ..|.|.|.|.: :.|..|..|..:...|   :..|.:..
 Worm    24 GQFMAVQMIGKGAYGVVYEVVRRNSPNTRFACKAELA-IDHNNLKTEWDLMTLLKDNKSKHNIIG 87

  Fly    76 IRYFHKEEHYQAMVMDLLGPSLERLFQFC-ERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            :. ...|.::..:||.|:||||..|.:.. .:.||:.|..:.|.|....:..:...|::|||:||
 Worm    88 VE-LGSERNFNYIVMHLVGPSLSDLRKTVPNKTFTLFTTAVCAIQCFDSLVEIQRIGYIHRDVKP 151

  Fly   140 DNFLMG-LGT-MSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRD 202
            .||.:| ||: ..|.||::||||.:...:....:..| |.:....||..|.|:..|..:|..|.|
 Worm   152 SNFAIGVLGSEEEKLVYVLDFGLCRNMFNKQKELRKP-RMKAPFRGTILYCSLNIHQRMEPGRHD 215

  Fly   203 DMVAVGYVLMYFNRGSLPWQDL-KASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGM 266
            |..::.|:::.|:...|||::: |..||:.|         ...::.|....|.||.|...|...:
 Worm   216 DFWSLLYMMIEFHLSDLPWENMSKEDTKKAK---------ETKLDGLLARCPPEFRMIRCYLLTL 271

  Fly   267 GFYDKPNYDFICRMFRMLRNGLNLRPGLIYDW------------DMLMMKFHNTQKN-------- 311
            .:..:|:|..:..:...:.......|.:..||            ...::|...|:|.        
 Worm   272 TYSKEPDYVKLREVLCQIMTSKKFTPDMPLDWQKGGPCEAIFKPQAAVVKHKGTKKKVSLAELLD 336

  Fly   312 -PGIGMRVFP----PKQKEDDGISGEPIIKDE 338
             |..|.:|:.    |:..|.:.:..|.:.|.:
 Worm   337 LPKPGGKVYTERDFPQPGEQEPMRDESVSKSD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 76/272 (28%)
SPS1 16..>242 CDD:223589 68/233 (29%)
C14A4.13NP_496292.1 PKc_like 29..286 CDD:389743 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.