DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C08F8.6

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001379133.1 Gene:C08F8.6 / 182416 WormBaseID:WBGene00007448 Length:380 Species:Caenorhabditis elegans


Alignment Length:346 Identity:96/346 - (27%)
Similarity:168/346 - (48%) Gaps:47/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIR 77
            ::..:::.:|:|.|:||.:| ......|:..|:|||....:...|..|..:...|:.|.|    |
 Worm    12 KVKKWQIDKKLGEGAFGAVY-KCSNPKGDLFALKVEGKDEKIQLLKMEVYVLNELKKAGG----R 71

  Fly    78 YF------HKEEHYQAMVMDLLGPSLERLFQFC-ERAFTIKTVLLLAEQMLRRVEYVHNRGFLHR 135
            :|      .:.:::..:||..:|.||..|.... .:.|::.|.:.:|.|.|..:|.:||.|:|||
 Worm    72 HFCNIEDKGQVDNFNYVVMTFVGLSLADLRAISPTKKFSMGTAISIARQSLEALEDMHNIGYLHR 136

  Fly   136 DIKPDNFLMGLGTMS--KQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVES 198
            |:||.|:.:|...::  ::||::|||:::|:......:..| |......||.:||.:..|||.|.
 Worm   137 DVKPGNYTIGRAEVNELRKVYVLDFGMARKFAHEDGTIKKP-RNVAGFRGTVKYAPVSCHAGREL 200

  Fly   199 ARRDDMVAVGYVLMYFNRGSLPW------QDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFT 257
            .|:||.....|:::...:|||||      ||:....:..:.:.|.:||       :..|.|.|:.
 Worm   201 CRQDDCETWLYMVVELTKGSLPWRNMTEIQDVGNEKRAIRRDPIVKKK-------MFGGCPREYL 258

  Fly   258 MYLNYCRGMGFYDKPNYDFICRMFR--MLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFP 320
            ..|.......|:|:|||:.|..:.|  |...|....|   |||:..:||  .|::.         
 Worm   259 DILEAIDKGQFFDEPNYERIYYLLREAMKNTGSTEYP---YDWEQSLMK--KTKEE--------- 309

  Fly   321 PKQKEDDGI--SGEPIIKDEK 339
             ::|:..|:  ..|.:||.::
 Worm   310 -QEKKKKGVVDQTEKVIKKKE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 81/279 (29%)
SPS1 16..>242 CDD:223589 71/240 (30%)
C08F8.6NP_001379133.1 STKc_TTBK 15..283 CDD:270919 81/280 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.