DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ttbk-5

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_501832.1 Gene:ttbk-5 / 182232 WormBaseID:WBGene00007305 Length:373 Species:Caenorhabditis elegans


Alignment Length:366 Identity:102/366 - (27%)
Similarity:163/366 - (44%) Gaps:76/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVR-HPQLNYERRIYRALRPAHG---L 73
            |.|:|.:.:.:..|.||.:|| :..:||:|.|:|.||:.:. ...:..|..|.|.|.....   :
 Worm    23 RFGSYTIEKSLDEGGFGQVYL-VRDNSGKRFALKAESNDMEGGSAIKLEALILRKLNDGESVIHV 86

  Fly    74 PRIRYFHKEEHYQAMVMDLLGPSLERLFQFC------ERAFTIKTVLLLAEQMLRRVEYVHNRGF 132
            |::....|.:.|..|||.|||.:|:     |      :..||..|...:..|.|..::|:|:.||
 Worm    87 PKLLLSGKRKKYCYMVMTLLGKNLK-----CLKNKRPKERFTRGTWSRIGIQCLYGLKYMHDCGF 146

  Fly   133 LHRDIKPDNFLMGL---GTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLT------------ 182
            :||||||.||:||.   ...::.|:::||||::.:...:         |.|.|            
 Worm   147 VHRDIKPQNFMMGNEDDKERARIVHILDFGLARSFAKFS---------ESSKTWSARRARGTAEF 202

  Fly   183 -GTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHE-KKISVSI 245
             ||.||.|...|...|..|.||:.::.:||:..| |.||||::      ||.|.:.. |.|....
 Worm   203 RGTLRYTSPNVHFRKEQGRVDDIWSLLFVLIELN-GGLPWQNV------QKREEVEAMKMIMTDQ 260

  Fly   246 EVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMF--RMLRNGLNLRPGLIYDWDMLMMKFHNT 308
            :|:....||...: :.:.|.:..|.:|:|..:.:..  .||..|......  :||:       .:
 Worm   261 DVMLNMPPCMCDI-IPHFRTLDCYMRPDYLLVFKALWQVMLNEGQTTSSR--FDWE-------TS 315

  Fly   309 QKNPGIGMRVFPPKQKEDD---------GISGEPIIKDEKC 340
            ..:|.|.    |...:..|         ||:|.|.:  :||
 Worm   316 DPDPSIS----PADWENPDGRFFKLDKIGINGPPPM--DKC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 85/291 (29%)
SPS1 16..>242 CDD:223589 77/252 (31%)
ttbk-5NP_501832.1 PKc_like 27..295 CDD:389743 85/290 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.