DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ttbk-7

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_506224.1 Gene:ttbk-7 / 179768 WormBaseID:WBGene00011283 Length:776 Species:Caenorhabditis elegans


Alignment Length:351 Identity:100/351 - (28%)
Similarity:175/351 - (49%) Gaps:39/351 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVRIG-----NYKVVRKIGCGSFGDIYLGIYIHS-GERVAIKVESSKVRHPQLNYERRIY 64
            ||:...:::|     .:|:..|||.|.||:||....:.: .|||||||||||.....|..|..:.
 Worm     4 SSEGEILQVGQVIRERWKIKAKIGGGGFGEIYEATDVQNHHERVAIKVESSKATKQVLKMEVAVL 68

  Fly    65 RALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFC-ERAFTIKTVLLLAEQMLRRVEYVH 128
            |.|:......:.....:.:.:..:||.|.|.:|..|.:.. ::.|.:.|.:.:..|:|..:..:|
 Worm    69 RRLQGKKHACKFYGCGRNDKFNYLVMSLQGKNLADLRREAPKQCFNLSTAVRVGIQILNGIREIH 133

  Fly   129 NRGFLHRDIKPDNFLMGLGTMS-KQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGA 192
            :.||||||:||.||.||..:.: :.||::||||:::||:....:..| |......||.|||::.|
 Worm   134 SIGFLHRDVKPSNFAMGRTSQTMRNVYMLDFGLARQYLNAKGEIRSP-RSAAGFRGTVRYAAVTA 197

  Fly   193 HAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFT 257
            |...|..|:||:.::.|:|..|.:|.|||:.:|..      :.:.:.|....:.||.:..|.|..
 Worm   198 HKNKEMGRQDDLWSLFYMLTEFLQGQLPWRKIKDK------DEVGKMKEEADLVVLLDDCPHEMH 256

  Fly   258 MYLNYCRGMGFYDKPNYDFICRMFRML--RNGLNL-RPGLIYDWDMLMMKFHNTQKNPGIGMRVF 319
            :::.:.:.:|:.|.|:|.::..:...:  .|.::. .|   |||::            |......
 Worm   257 LFVAHLKVLGYADTPDYVYLESLLNKIVAENEISWDEP---YDWEL------------GYDNMAT 306

  Fly   320 PPKQKEDDGISGE------PIIKDEK 339
            ..||:.:..:|..      .:|||::
 Worm   307 RQKQQANGNLSARLKSHTTAVIKDQR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 85/267 (32%)
SPS1 16..>242 CDD:223589 77/228 (34%)
ttbk-7NP_506224.1 STKc_TTBK 19..281 CDD:270919 85/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.