DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and K11C4.1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_504751.1 Gene:K11C4.1 / 179078 WormBaseID:WBGene00019642 Length:308 Species:Caenorhabditis elegans


Alignment Length:308 Identity:88/308 - (28%)
Similarity:153/308 - (49%) Gaps:41/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALR---PAHGLP 74
            |:..:.|.:|:|.|:||.:| .:...:|...|:|.|.:..:.|.|..|..:.:.|.   |.| :.
 Worm    15 RVNRFTVFKKLGEGTFGAVY-AVRDDAGAEHALKAELATEKIPLLKLELYVMQKLSMKGPKH-MA 77

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERA-----FTIKTVLLLAEQMLRRVEYVHNRGFLH 134
            .:....:.|::..:||..||.||    |..::.     .|:.:.:..:.|.|..:|.:|..||||
 Worm    78 TLIDKGRHENFNYIVMKFLGKSL----QDAKKTGPDGHLTLGSAIGASIQCLEALEELHWCGFLH 138

  Fly   135 RDIKPDNFLMG---LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGV 196
            ||:||.||.:|   ||.:.| ::::||||.:|::| ...|.:..|.:....||.|||.|.:|...
 Worm   139 RDVKPGNFCLGRAELGELRK-IFVLDFGLCRKFVD-DRNVMLQPRRKAPYRGTPRYAPIASHNRA 201

  Fly   197 ESARRDDMVAVGYVLMYFNRGSLPWQ---------DLKASTKQQKYERIHEKKISVSIEVLCEGF 252
            |..|:||:.:..|:|:.|...:|||:         ::|   |..:::.:        :..|..|.
 Worm   202 EHGRKDDVESWFYMLVDFTNAALPWKVVNEIPQVGEMK---KNSRFDPL--------VTQLLAGC 255

  Fly   253 PC-EFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            |. |:.:.:|:..|:.|:.:|||..|....:.|....|::. ..|||:
 Worm   256 PVDEYRLIMNHIDGLSFFMEPNYGLIYSTLKRLMQTRNIQE-FPYDWE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 82/285 (29%)
SPS1 16..>242 CDD:223589 71/245 (29%)
K11C4.1NP_504751.1 PKc_like 18..286 CDD:389743 82/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.