DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Y38H8A.3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_502596.1 Gene:Y38H8A.3 / 178315 WormBaseID:WBGene00012637 Length:308 Species:Caenorhabditis elegans


Alignment Length:300 Identity:78/300 - (26%)
Similarity:139/300 - (46%) Gaps:27/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIR 77
            ::..:.:.:|:|.|.||.:| .::..:| :.|:|||.:..:...|..|..:...|.....    |
 Worm    13 QVERWSIEKKLGEGGFGAVY-RVFDATG-KYAMKVEGANEQIQVLKLEVSVLNKLSKRGN----R 71

  Fly    78 YFHKEE------HYQAMVMDLLGPSLERLFQFCERA-----FTIKTVLLLAEQMLRRVEYVHNRG 131
            :|.|.|      ::..:||.|:|.||:.|    .:|     .::...:.:..|.|..:|.:||.|
 Worm    72 HFCKIEDKGRFGNFNYVVMTLVGKSLQDL----NKAGVGGHMSMGCSIGIGIQSLEALEDLHNIG 132

  Fly   132 FLHRDIKPDNFLMGLGTMS--KQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHA 194
            :||||:||.|:.:|...::  ::||::|||:.:|:......:..| |:.....||.:||.|..|.
 Worm   133 YLHRDVKPGNYTIGRPELNEIRKVYILDFGMCRKFTGNDGTIRKP-RQAAGFRGTVKYAPISCHL 196

  Fly   195 GVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMY 259
            ..|..|:||:....|:.:..:.|::|||.:....:..:.::.....:.......|   |.:|...
 Worm   197 QRELCRKDDLETWMYMQVELSHGTIPWQYISDMNQVGQAKQAIRNNLGSLFPPPC---PHQFQDI 258

  Fly   260 LNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            :.....|.:||.|||..|..|.|.............|||:
 Worm   259 MRMVDAMKYYDAPNYQAIYGMMRQAYGACGSNENAPYDWE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 73/277 (26%)
SPS1 16..>242 CDD:223589 63/238 (26%)
Y38H8A.3NP_502596.1 STKc_TTBK 16..281 CDD:270919 74/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.