DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C27D8.1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_502428.1 Gene:C27D8.1 / 178226 WormBaseID:WBGene00007777 Length:327 Species:Caenorhabditis elegans


Alignment Length:305 Identity:95/305 - (31%)
Similarity:148/305 - (48%) Gaps:14/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVES--SKVRHPQLNYERRIYRALRPAHGLPRI-- 76
            ||.|||.:|.|.||.:||.....|.::.|:|||.  .|.:|.:|..|..|.:.:.......:|  
 Worm    23 NYTVVRLLGEGGFGAVYLVQDNKSKKQSAMKVERKIEKRKHSKLKMEIAILKLVGSGKHFTQIVD 87

  Fly    77 RYFHKEEHYQAMVMDLLGPSLERL-FQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPD 140
            |....:|.:..:||:|:|.||..| ....::.|:..|.|.::.|.|..||.:|..||:|||:||.
 Worm    88 RGKKDKEGFFFLVMELVGKSLADLKADRPDKVFSFATGLGVSCQCLEAVEELHKTGFIHRDLKPQ 152

  Fly   141 NFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMV 205
            |:..||......:|::|||:::|||:....:..| ||.....||.|:|.|..|...|...:||..
 Worm   153 NYACGLDEKRHNIYILDFGIARKYLNTKNELKTP-RETVGFKGTVRFAPIACHRNTEMGPKDDCE 216

  Fly   206 AVGYVLM-YFNRGSLPWQDL--KASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMG 267
            :..|:|: ......|||:.|  |....::|.|...:|:.|:...:....:   .:..|:|..|..
 Worm   217 SWFYLLLDLIVPSGLPWRKLSDKHEVLKEKEECRKDKRSSLFAGLRQTDY---LSKVLDYIDGRA 278

  Fly   268 FYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNP 312
            :.|:.:|.||.:.........||.....|||:  :.|...|.|.|
 Worm   279 YQDRVDYQFIYKNLAEACKVCNLDIDSPYDWE--LQKPEKTSKEP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 86/272 (32%)
SPS1 16..>242 CDD:223589 78/233 (33%)
C27D8.1NP_502428.1 PKc_like 23..290 CDD:389743 86/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.