DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C09B9.4

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_500708.1 Gene:C09B9.4 / 177271 WormBaseID:WBGene00015629 Length:359 Species:Caenorhabditis elegans


Alignment Length:352 Identity:98/352 - (27%)
Similarity:153/352 - (43%) Gaps:88/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSSQN--------REVRIGN--YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVES-SKVRHPQLN 58
            |:|.|        :.:|:|:  ||:...|..|.|..::|  ....|...|:|||| ||...|.|.
 Worm     7 RNSTNDLLMPLLGKRIRLGDHVYKMCDSIATGPFSSVFL--VEKDGIPYAMKVESQSKCLRPVLK 69

  Fly    59 YERRIYRALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFC-ERAFTIKTVLLLAEQMLR 122
            .:..:.|||....|.|.:....:.|:::.:||.|:||.|..|.:|. ::.||..||..:|.|.|.
 Worm    70 LDHAVLRALGHQSGFPSLTSAGRTENFKYVVMQLVGPDLSMLLEFAPQQRFTSSTVYKIALQTLD 134

  Fly   123 RVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSL------ 181
            |:..:|..|:|:||:|..||.:|||..|..||::||||::|||:        :...|||      
 Worm   135 RLRVLHEAGWLNRDVKAQNFAVGLGEESSIVYMLDFGLTRKYLE--------HNGSRSLLRPHGP 191

  Fly   182 -TGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSI 245
             .||..||.:.:....:.:..||:....|::::..:|.|||.:.|.:....|   :.|.|:    
 Worm   192 SVGTFPYAPLASLGFCDQSPIDDIEGWLYMIVHLLKGGLPWHNSKRALNLPK---VREWKM---- 249

  Fly   246 EVLCEGFPCEFTMYLNYCRGMGF------------------------YDKPNYDFICRM-FRMLR 285
                            |||..|.                        ::.|:|:.|..| ..:.|
 Worm   250 ----------------YCRRPGGKHYLFAGIPKGWADIFDVIVNTAPHETPDYNKIANMVLSIAR 298

  Fly   286 NGLNLRPGLIYDWDMLMMKFHNTQKNP 312
            |.| :.....:||          |.||
 Worm   299 NEL-IDLTAPFDW----------QVNP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 85/300 (28%)
SPS1 16..>242 CDD:223589 77/236 (33%)
C09B9.4NP_500708.1 PKc_like 29..289 CDD:389743 83/292 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.