DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and F26A1.3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_497999.1 Gene:F26A1.3 / 175639 WormBaseID:WBGene00017802 Length:512 Species:Caenorhabditis elegans


Alignment Length:215 Identity:48/215 - (22%)
Similarity:81/215 - (37%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ESSKVRHPQ--LNYERRIYRALRPAHGLPRIRYFHKEE--------------------------H 84
            :|.|.:..|  |...||:....|..|.:..:|.|:..|                          :
 Worm   197 KSKKTKEVQQILKVGRRMNANARIEHEIAILRCFYPVEQKRKEGEKGPTHITPIIANGDAGGSPY 261

  Fly    85 YQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTM 149
            :...|||:   :||||.|.....|.......:.::.:..::..|:|..:||||||.|.|: ....
 Worm   262 FTMPVMDV---NLERLKQQIGHKFRWVDSFYIGQESMIGIKECHDRSIIHRDIKPTNLLL-CREP 322

  Fly   150 SKQVYLIDFGLS-----KKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRD----DMV 205
            :...:|.|||.|     .|.:.....:.:|            |.|..||...:...:.    |:.
 Worm   323 NMFWWLCDFGDSCRIGEVKIISPPDALTLP------------YLSRAAHEATQKPMKATIAMDIE 375

  Fly   206 AVGYVLM-YFNRGSLPWQDL 224
            :..|:|: .|  ..|||:::
 Worm   376 SWFYMLLDLF--VVLPWKNM 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 48/215 (22%)
SPS1 16..>242 CDD:223589 48/215 (22%)
F26A1.3NP_497999.1 PKc_like 208..432 CDD:389743 45/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.