DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C28A5.6

DIOPT Version :10

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_497900.2 Gene:C28A5.6 / 175579 WormBaseID:WBGene00007791 Length:1064 Species:Caenorhabditis elegans


Alignment Length:116 Identity:28/116 - (24%)
Similarity:52/116 - (44%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IHSGERVAIKVESSK-VRHPQ----LNYERRIYRAL-----RPAHGLPRIRYFHKEEHYQAMVMD 91
            |.||...:.|:.|.| ..|.|    |:.||:|...|     .|:| :.|:.....::.::.::.:
 Worm   464 IKSGCMCSAKLVSRKNPEHLQLQKNLDKERKILYDLLPELSNPSH-IARLVDIGYDDDFKFLIFE 527

  Fly    92 LLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNF 142
            ..|..|..||..........|:.|::......::.:|:...:|.||:|.:|
 Worm   528 DFGMDLLTLFDEFGAVLNPTTMFLISYFTFNAIKELHSFDIVHLDIRPSSF 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 28/116 (24%)
C28A5.6NP_497900.2 Protein Kinases, catalytic domain 459..>592 CDD:473864 28/116 (24%)

Return to query results.
Submit another query.