DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C28A5.6

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_497900.2 Gene:C28A5.6 / 175579 WormBaseID:WBGene00007791 Length:1064 Species:Caenorhabditis elegans


Alignment Length:116 Identity:28/116 - (24%)
Similarity:52/116 - (44%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IHSGERVAIKVESSK-VRHPQ----LNYERRIYRAL-----RPAHGLPRIRYFHKEEHYQAMVMD 91
            |.||...:.|:.|.| ..|.|    |:.||:|...|     .|:| :.|:.....::.::.::.:
 Worm   464 IKSGCMCSAKLVSRKNPEHLQLQKNLDKERKILYDLLPELSNPSH-IARLVDIGYDDDFKFLIFE 527

  Fly    92 LLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNF 142
            ..|..|..||..........|:.|::......::.:|:...:|.||:|.:|
 Worm   528 DFGMDLLTLFDEFGAVLNPTTMFLISYFTFNAIKELHSFDIVHLDIRPSSF 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 28/116 (24%)
SPS1 16..>242 CDD:223589 28/116 (24%)
C28A5.6NP_497900.2 SPS1 457..>663 CDD:223589 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.