DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and kin-19

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001369852.1 Gene:kin-19 / 175524 WormBaseID:WBGene00002202 Length:341 Species:Caenorhabditis elegans


Alignment Length:299 Identity:176/299 - (58%)
Similarity:231/299 - (77%) Gaps:2/299 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHK 81
            ||::||||.|||||||:.|.:.:||.||||:||::.|||||.||.::||.|:...|:|.||::..
 Worm    16 YKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQGGVGIPHIRWYGT 80

  Fly    82 EEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGL 146
            |..|..:||||||||||.||.||.|.||:||||:||:||:.|:||||.:.|:||||||||||||:
 Worm    81 EREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMGI 145

  Fly   147 GTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYVL 211
            |....:::||||||:|||.|..|..||||||:::||||||||||.||.|:|.:|||||.::||||
 Worm   146 GRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVL 210

  Fly   212 MYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDF 276
            ||||||:||||.|||:||:||||:|.|||::.|:|.||:|||.||.|||:|.||:.|.:.|:|.:
 Worm   211 MYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMY 275

  Fly   277 ICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKN--PG 313
            :.::||:|...||.:....:||.||..|...:|.:  ||
 Worm   276 LRQLFRILFRTLNHQYDYTFDWTMLKQKAQQSQSSGVPG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 163/263 (62%)
SPS1 16..>242 CDD:223589 145/224 (65%)
kin-19NP_001369852.1 STKc_CK1_alpha 15..280 CDD:271030 163/263 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.