DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C56C10.6

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_495333.1 Gene:C56C10.6 / 174087 WormBaseID:WBGene00016963 Length:422 Species:Caenorhabditis elegans


Alignment Length:324 Identity:88/324 - (27%)
Similarity:157/324 - (48%) Gaps:39/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERLRSSQNREVRIG-------NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHP-QL 57
            |..::.:.|..|.:.       :::|:||:|.|..|.:||...:......|:|.||:..... .|
 Worm     1 MTEIKHTDNGTVELPKGKIVGCSWQVIRKLGEGGCGSVYLVKNLEDETEAAMKAESNGAAGGCVL 65

  Fly    58 NYERRIYRALRPAHGLPRIRYF---HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQ 119
            ..|..|   |:...|.|.:..|   .:...:..::|.|||.||.::.:...|..|:.:.:.:|..
 Worm    66 KLEVAI---LKKLSGKPHVCQFLFAARLTDFTYVIMTLLGESLNKIVKRIARQITVSSQVRIAAN 127

  Fly   120 MLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQ---VYLIDFGLSKKYL----DITTGVHIPYRE 177
            :|..::.:|:.||:|||:||.|..:|..|.:.:   .:::||||:::::    |..:.:.:....
 Worm   128 VLFCLKQIHDIGFIHRDLKPANMALGYKTNNDECRFFHVLDFGLARQFVVSQSDQPSKLMMRRPR 192

  Fly   178 ERSL-TGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKI 241
            |||| .||.||.||..|...|..|.||:.::.|:|... ||.|||..........:.:|:|    
 Worm   193 ERSLFRGTTRYCSIRMHDRAEQGRVDDLWSMVYLLAEL-RGPLPWSSQSDKRVVGEMKRLH---- 252

  Fly   242 SVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLI-----YDWDM 300
              |.||:.:..|.||.....|.|.:.::.:|:|.   ::|.:|.:.::  .|..     :||:|
 Worm   253 --SDEVVLQNSPMEFLEIAKYLRSLTYFHRPDYH---KIFMLLISVMS--KGKFAWNDPFDWEM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 79/276 (29%)
SPS1 16..>242 CDD:223589 69/237 (29%)
C56C10.6NP_495333.1 PKc_like 24..290 CDD:389743 80/278 (29%)
CAF-1_p150 322..>407 CDD:371622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.