DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and F59A6.4

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_494922.2 Gene:F59A6.4 / 173865 WormBaseID:WBGene00019086 Length:762 Species:Caenorhabditis elegans


Alignment Length:313 Identity:79/313 - (25%)
Similarity:140/313 - (44%) Gaps:51/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGER-----VAIKVESSKVRHPQLNYERRIYRALRPAHGLPRI 76
            :||:..:|.|.|||:|   .:|...:     .|:|.||.:.....|..:..:...::.|..    
 Worm   444 WKVINLLGSGGFGDVY---KVHRESQPITKCYALKTESEEGEKRYLRLKIEVTVMMKTAEK---- 501

  Fly    77 RYFHKEEHY-----------------QAMVMDLLGPSLERL-FQFCERAFTIKTVLLLAEQMLRR 123
               .||..:                 :.:||.|:|||||.: .::...:|:..|...:|.|.:..
 Worm   502 ---KKENKFKNFIEFVDRGKCEQLKCKYVVMGLVGPSLEDIRRKYLLGSFSKHTSFNVAIQTVTA 563

  Fly   124 VEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYA 188
            ::.:|:.|:|||||||.|:.:||......||::|||::|.|:| ..|.|...|::....||.|||
 Worm   564 LQDLHSIGYLHRDIKPANYAVGLEDREDTVYMLDFGIAKLYVD-ENGEHKVKRKKVKFLGTLRYA 627

  Fly   189 SIGAHAGVESARRDDM---VAVGYVLMYFNRGSLPWQDLKA-----STKQQKYERIHEKKISVSI 245
            ........|..|:||:   :.:.:.||..:.| :||:.|.:     .:|.:.:.......:|.::
 Worm   628 CRACMMQQEQGRKDDLETWIYLVFDLMDESHG-MPWRSLCSPKEILKSKNEFFTNFDSSSVSATL 691

  Fly   246 EVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDW 298
            :.| :|.       ::|...|.:...|:||:|....:........:.....||
 Worm   692 KRL-KGL-------VSYVDNMQYETTPDYDYIINFLKTTATEAGAKISKKLDW 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 77/294 (26%)
SPS1 16..>242 CDD:223589 68/255 (27%)
F59A6.4NP_494922.2 PKc_like 120..372 CDD:304357
SPS1 121..>274 CDD:223589
SPS1 443..>627 CDD:223589 55/193 (28%)
PKc_like 444..720 CDD:304357 77/295 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.