DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and T05A7.6

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_494824.1 Gene:T05A7.6 / 173804 WormBaseID:WBGene00020223 Length:758 Species:Caenorhabditis elegans


Alignment Length:351 Identity:90/351 - (25%)
Similarity:147/351 - (41%) Gaps:68/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIH-----SGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRI 76
            :|||..:|.|.|||:|   .:|     |.:..|:|.||.:.....|..:..:...::.|......
 Worm   440 WKVVNLLGSGGFGDVY---KVHRESQASNKCYALKTESEEGEKRYLRLKVEVTVMMKTAEKKKDN 501

  Fly    77 RYFH--------KEEHYQA--MVMDLLGPSLERL-FQFCERAFTIKTVLLLAEQMLRRVEYVHNR 130
            ::.:        |.|..:.  :||.|:|||||.: .::...:|:..|...:|.|.:..:..:|:.
 Worm   502 KFKNFIEFVDRGKCEQLKCKFVVMGLVGPSLEDIRRKYLLASFSKHTSFNVAIQTVTALRDLHSL 566

  Fly   131 GFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAG 195
            |:|||||||.|:.:||......||::|||::|.|:| ..|||...|::....||.|||.......
 Worm   567 GYLHRDIKPANYAVGLDEREDTVYMLDFGIAKLYVD-ENGVHKIKRKKVKFLGTLRYACRACMMQ 630

  Fly   196 VESARRDDMVAVGYVLMYFN----RGSLPWQDL--------KASTKQQKYERIHEKKISVSIEVL 248
            .|..|:||:..  ::.:.|:    ...:||:.|        ..:|....::......|...::.|
 Worm   631 QEQGRKDDLET--WIYLVFDLMDEAHGMPWRALCDPREILKSKNTFFATFDNFQFSNILKRLKDL 693

  Fly   249 CEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNPG 313
                       :.|...|.:...|:|.:|....:...|.:..:.....||   |.|.        
 Worm   694 -----------VVYVDDMQYDTTPDYSYILNFLKTTANDVGAKITKKLDW---MGKL-------- 736

  Fly   314 IGMRVFPPKQKEDDGISGEPIIKDEK 339
                    ||||.|..|.    |.||
 Worm   737 --------KQKEFDSESE----KSEK 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 76/291 (26%)
SPS1 16..>242 CDD:223589 69/252 (27%)
T05A7.6NP_494824.1 SPS1 100..>321 CDD:223589
PKc_like 116..368 CDD:304357
SPS1 439..>623 CDD:223589 58/186 (31%)
PKc_like 440..716 CDD:304357 76/292 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.