DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and C34B2.3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_492794.2 Gene:C34B2.3 / 172964 WormBaseID:WBGene00016388 Length:351 Species:Caenorhabditis elegans


Alignment Length:309 Identity:81/309 - (26%)
Similarity:142/309 - (45%) Gaps:19/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NYKVVRKIGCG-SFGDIYLGIYIHSGERV-AIKVESSKVRHPQLNYERRIYRALRPAHGLPRI-R 77
            |:|||:.|... .|..||:..::...::: |:|||........|.:|..:...:...:...:. :
 Worm    41 NWKVVKAIQSDKGFNTIYVAEHVQKKKKMAAVKVERKTEAIKMLQFELFVLLTVEKKNQCKQFCK 105

  Fly    78 YFHK--EEHYQAMVMDLLGPSLERLFQFCERA-FTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .|.|  |:.|..:.:.|.|.||..|.:..... .|:...|.:|:|.|:.:|.:|..||:||::.|
 Worm   106 LFEKGNEKEYNWIAITLCGKSLRALRKNQPTGKLTVACGLSVAQQCLKGLEELHRMGFIHRNVAP 170

  Fly   140 DNFLMGLGTMSKQ-----VYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESA 199
            ..|.:|..|...|     :|::|||.:.:|:.....:..|........|:.|:....|::.||.:
 Worm   171 SVFAIGRYTGDNQSDLRNIYILDFGFAHQYMIKDGTLKPPSAHPWKYVGSLRHMPRAAYSKVEFS 235

  Fly   200 RRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCR 264
            |.:|:....|:.:...:|.|||..||...:...|:::...  .:.:..:..|.|.||...:....
 Worm   236 RMEDLEMWFYMSVELVKGCLPWAHLKKPKEVHDYQKLCRN--GLQMREMLGGLPPEFVDIMQIVD 298

  Fly   265 GMGFYDKPNYDFICRMF--RMLRNGLNLRPGLIYDWDML-MMKFHNTQK 310
            .:.|.|.|||..|..:.  .:|.:|.|..|   |||:.. :.:|.|.||
 Worm   299 KLSFTDTPNYTEIYGLLTNAILFSGKNEFP---YDWEEAEINEFKNPQK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 70/275 (25%)
SPS1 16..>242 CDD:223589 60/236 (25%)
C34B2.3NP_492794.2 STKc_TTBK 41..316 CDD:270919 70/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.