DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and H05L14.1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_492198.1 Gene:H05L14.1 / 172575 WormBaseID:WBGene00010366 Length:794 Species:Caenorhabditis elegans


Alignment Length:363 Identity:98/363 - (26%)
Similarity:155/363 - (42%) Gaps:87/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSSQNREVRIGN----YKVVRKIGCGSFGDIYLGIYIHSGE-----RVAIKVES--SKVRHPQL 57
            :|...|.:..|.|    :||||.:|.|.|||:| .::....:     ..|:|.||  .|....:|
 Worm   444 VRKIMNPDDVITNGQYAWKVVRLLGSGGFGDVY-KVFDDKAKGPKKTHYALKTESEGGKKAMLRL 507

  Fly    58 NYERRIYRALRPAHGLPR---IRYF------HKEEHYQA--MVMDLLGPSLERLFQFCERAFTI- 110
            ..|.::...:..|....:   .|:|      .|.|..:.  :||.|:||||:.    |.|.|.: 
 Worm   508 KVEMQVMITISDARKKSKGDVNRHFVDFIDRGKSEELKCKYIVMSLVGPSLDD----CRRKFGVN 568

  Fly   111 ----KTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGV 171
                .|..::|.|.|..:..:||.|:|||||||.||.:|:|.....|:::|||:.:.|||..|..
 Worm   569 LSNTSTPYIIAIQTLESIRDLHNLGYLHRDIKPANFAVGVGAKESTVFMLDFGIGRSYLDPKTKQ 633

  Fly   172 HIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFN----RGSLPWQDLKASTKQQK 232
            |...|::....||.||||......|:..|:||:..  ::.|.|:    :..:.|:      ||:.
 Worm   634 HRAPRKKVKFLGTLRYASRACMLEVDQGRKDDLEC--WIYMVFDIFDPKNGVSWK------KQRD 690

  Fly   233 YERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYD-KPNYDFICRMFRMLRNGLNLRPGLIY 296
            ..:|.|.|                         ..|:| |..||:.         .::|||.:||
 Worm   691 RVKIREAK-------------------------QLFFDGKAQYDYA---------PISLRPIIIY 721

  Fly   297 DWDMLMMKFHNTQKNPGIGMRVFPPKQKEDDGISGEPI 334
               :..::|..|.:...:...::     .....||.||
 Worm   722 ---INSLQFQTTPEYANLVKTLY-----TSSSASGYPI 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 84/296 (28%)
SPS1 16..>242 CDD:223589 79/256 (31%)
H05L14.1NP_492198.1 PKc_like 137..385 CDD:304357
SPS1 194..>369 CDD:223589
PKc_like 461..736 CDD:304357 90/324 (28%)
SPS1 461..>651 CDD:223589 64/194 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.