DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CSNK1G3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_016864546.1 Gene:CSNK1G3 / 1456 HGNCID:2456 Length:481 Species:Homo sapiens


Alignment Length:322 Identity:145/322 - (45%)
Similarity:213/322 - (66%) Gaps:32/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVRIG-NYKVVRKIGCGSFGDIYL-------------------------GIYIHSGERVA 44
            ||.:..:.:| |::|.:|||||:||::.|                         |..:::.|.||
Human    31 SSSSGVLMVGPNFRVGKKIGCGNFGELRLDQREKPEGCQGTSASLICDFRLCAQGKNLYTNEYVA 95

  Fly    45 IKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFT 109
            ||:|..|.|.|||:.|.|.|:.|....|:|::.||.....|.|||::|||||||.||..|:|.|:
Human    96 IKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFS 160

  Fly   110 IKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGL-GTMSKQV-YLIDFGLSKKYLDITTGVH 172
            :||||::|.|::.|:||||::..::||:||:|||:|. |..::|| ::|||||:|:|:|..|..|
Human   161 LKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKH 225

  Fly   173 IPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIH 237
            |||||.:||||||||.||..|.|.|.:||||:.|:|::.|||.|||||||.|||.|.:::|::|.
Human   226 IPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG 290

  Fly   238 EKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            :.|.:..||||||.||.|...||.|.|.:.|::||:||::.::|..|.:    |.|.::|::
Human   291 DTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFD----RKGYMFDYE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/291 (47%)
SPS1 16..>242 CDD:223589 119/252 (47%)
CSNK1G3XP_016864546.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.