DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CSNK1G2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_005259555.1 Gene:CSNK1G2 / 1455 HGNCID:2455 Length:445 Species:Homo sapiens


Alignment Length:331 Identity:148/331 - (44%)
Similarity:215/331 - (64%) Gaps:39/331 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSS--QNREVRIG-NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYR 65
            :|||  .:..:.:| |::|.:|||||:||::.||..:::.|.||||:|..|.|.|||:.|.|.|:
Human    30 IRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK 94

  Fly    66 AL------RP------------------------AHGLPRIRYFHKEEHYQAMVMDLLGPSLERL 100
            .|      ||                        |.|:|::.||.....|.|||::|||||||.|
Human    95 QLSATGTGRPAGGAGAAQGQGGGCRRTPVRLSSAAEGVPQVYYFGPCGKYNAMVLELLGPSLEDL 159

  Fly   101 FQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQ--VYLIDFGLSKK 163
            |..|:|.||:||||::|.|::.|:||||.:..::||:||:|||:|.....:|  :::|||||:|:
Human   160 FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKE 224

  Fly   164 YLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKAST 228
            |:|..|..||||||.:||||||||.||..|.|.|.:||||:.|:|::.|||.|||||||.|||.|
Human   225 YIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADT 289

  Fly   229 KQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPG 293
            .:::|::|.:.|.:..||||||.||.|...||.|.|.:.|::||:||::.::|..|.:    |.|
Human   290 LKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFD----RSG 350

  Fly   294 LIYDWD 299
            .::|::
Human   351 FVFDYE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 139/296 (47%)
SPS1 16..>242 CDD:223589 121/257 (47%)
CSNK1G2XP_005259555.1 SPS1 45..398 CDD:223589 144/316 (46%)
STKc_CK1_gamma 45..362 CDD:271028 144/316 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.