DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CSNK1E

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens


Alignment Length:332 Identity:180/332 - (54%)
Similarity:232/332 - (69%) Gaps:24/332 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLP 74
            |:|:|| |::.||||.|||||||||..|.|||.||||:|..|.:||||:.|.:.|:.::...|:|
Human     2 ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 66

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .|::...|..|..|||:|||||||.||.||.|.|::|||||||:||:.|:||:|::.|:|||:||
Human    67 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   140 DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDM 204
            ||||||||.....||:|||||:|||.|..|..||||||.::||||||||||..|.|:|.:||||:
Human   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   205 VAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFY 269
            .::||||||||.||||||.|||:||:||||||.|||:|..|||||:|:|.||:.|||:||.:.|.
Human   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 261

  Fly   270 DKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNP--------------------GI 314
            |||:|.::.::||.|.:........::||:||  || ...:||                    |.
Human   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML--KF-GAARNPEDVDRERREHEREERMGQLRGS 323

  Fly   315 GMRVFPP 321
            ..|..||
Human   324 ATRALPP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 162/265 (61%)
SPS1 16..>242 CDD:223589 142/226 (63%)
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 164/273 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.