DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Ttbk2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_542966.2 Gene:Ttbk2 / 140810 MGIID:2155779 Length:1312 Species:Mus musculus


Alignment Length:352 Identity:104/352 - (29%)
Similarity:172/352 - (48%) Gaps:45/352 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHK 81
            :||:||||.|.||:||..:.:.:.|.||:||||::.....|..|..:.:.|:....:.|.....:
Mouse    90 WKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGR 154

  Fly    82 EEHYQAMVMDLLGPSLERLFQFCER-AFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMG 145
            .:.:..:||.|.|.:|..|.:...| .|||.|.|.|.:|:|..:|.:|:.|||||||||.||.||
Mouse   155 NDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMG 219

  Fly   146 -LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
             ..:..::.:::||||::::.:....|. |.|......||.|||||.||...|..|.||:.::.|
Mouse   220 RFPSTCRKCFMLDFGLARQFTNSCGDVR-PPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFY 283

  Fly   210 VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNY 274
            :|:.|..|.|||:.:|..      |::...|......::.:..|.||:.:|::...:.::.||:|
Mouse   284 MLVEFVVGQLPWRKIKDK------EQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDY 342

  Fly   275 DFICRMFRMLRNGLNLRPGLI----YDWDML----MMKFHNTQKNPGIGMRVFP----------- 320
            ..:..:|   .|.:... |:|    :||:..    .:....|...|.:..|:.|           
Mouse   343 QLLTSVF---DNSIKTF-GVIESDPFDWEKSGTDGSLTTTTTSATPQLHTRLTPAAIGIANATPI 403

  Fly   321 -------------PKQKEDDGISGEPI 334
                         |.::..||.:|.|:
Mouse   404 PGDLLRENTDEVFPDEQLSDGENGIPV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 89/265 (34%)
SPS1 16..>242 CDD:223589 82/226 (36%)
Ttbk2NP_542966.2 STKc_TTBK2 89..350 CDD:271031 90/269 (33%)
Pkinase 90..329 CDD:278497 85/245 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.