DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1g2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_598763.1 Gene:Csnk1g2 / 103236 MGIID:1920014 Length:442 Species:Mus musculus


Alignment Length:334 Identity:147/334 - (44%)
Similarity:211/334 - (63%) Gaps:44/334 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVR----------IG-NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNY 59
            |..|..||          :| |::|.:|||||:||::.||..:::.|.||||:|..|.|.|||:.
Mouse    24 SRSNHGVRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHL 88

  Fly    60 ERRIYRALRP---------------------------AHGLPRIRYFHKEEHYQAMVMDLLGPSL 97
            |.|.|:.|..                           |.|:|::.||.....|.|||::||||||
Mouse    89 EYRFYKQLSTTGEADSGTGPALLGQQWLRTPSMDVSFAEGVPQVYYFGPCGKYNAMVLELLGPSL 153

  Fly    98 ERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQ--VYLIDFGL 160
            |.||..|:|.||:||||::|.|::.|:||||.:..::||:||:|||:|.....:|  :::|||||
Mouse   154 EDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGL 218

  Fly   161 SKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLK 225
            :|:|:|..|..||||||.:||||||||.||..|.|.|.:||||:.|:|::.|||.|||||||.||
Mouse   219 AKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 283

  Fly   226 ASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNL 290
            |.|.:::|::|.:.|.:..||||||.||.|...||.|.|.:.|::||:||::.::|..|.:    
Mouse   284 ADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFD---- 344

  Fly   291 RPGLIYDWD 299
            |.|.::|::
Mouse   345 RSGYVFDYE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/293 (47%)
SPS1 16..>242 CDD:223589 119/254 (47%)
Csnk1g2NP_598763.1 STKc_CK1_gamma 45..359 CDD:271028 142/313 (45%)
SPS1 45..>356 CDD:223589 142/313 (45%)
CK1gamma_C 359..401 CDD:289378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.