DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Vrk3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_598706.1 Gene:Vrk3 / 101568 MGIID:2182465 Length:453 Species:Mus musculus


Alignment Length:282 Identity:69/282 - (24%)
Similarity:129/282 - (45%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RVAIKVESSKVR-HPQLNYERRIYRALR----------PAHGLPR-IRYFHKEEHYQAMVMDLLG 94
            |.::|::|...| ..:.|:.:|:.:.|:          |...:|. |.:...::.|:.:|...||
Mouse   178 RFSLKLDSKDGRLFNEQNFFQRVAKPLQVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPSLG 242

  Fly    95 PSLE-RLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDF 158
            .||: .|....:...:.:.||.:|.::|..:||:|...::|.::..:|..:....:| ||.|:.:
Mouse   243 RSLQSALDDNPKHVVSERCVLQVACRLLDALEYLHENEYVHGNLTAENVFVNPEDLS-QVTLVGY 306

  Fly   159 GLSKKYLDITTGVHIPYRE-ERS-LTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPW 221
            |.:.:|  ...|.|:.|:| .|| ..|...:.|:..|.|...:||.|:..:||.::.:..|||||
Mouse   307 GFTYRY--CPGGKHVAYKEGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPW 369

  Fly   222 QDL-----KASTKQQKYERIHEKKISV------SIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYD 275
            .:.     |.:.::|||....|:.:.:      :.|.|.|        ||.....:.:.:||.|.
Mouse   370 TNCLPNTEKITRQKQKYLDSPERLVGLCGRWNKASETLRE--------YLKVVMALNYEEKPPYA 426

  Fly   276 FICRMFRMLRNGLNLRPGLIYD 297
            .:......|...:.:.|   ||
Mouse   427 TLRNSLEALLQDMRVSP---YD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 65/264 (25%)
SPS1 16..>242 CDD:223589 57/219 (26%)
Vrk3NP_598706.1 zinc_ribbon_2 4..26 CDD:379084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..123
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
PKc_like 134..436 CDD:389743 65/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.