DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ttbk1b

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_017207296.1 Gene:ttbk1b / 100000353 ZFINID:ZDB-GENE-100609-5 Length:1219 Species:Danio rerio


Alignment Length:346 Identity:105/346 - (30%)
Similarity:174/346 - (50%) Gaps:35/346 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHK 81
            :||::|||.|.||:||....:.:.|.||:||||::.....|..|..:.:.|:..:.:.:.....:
Zfish    34 WKVLKKIGGGGFGEIYEAYDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGR 98

  Fly    82 EEHYQAMVMDLLGPSLERLFQFCER-AFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMG 145
            .:.:..:||.|.|.:|..|.:...| .|::.|.|.|.:|:|..:|.:|:.|||||||||.||.||
Zfish    99 NDKFNYVVMQLQGRNLADLRRSQPRGTFSMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMG 163

  Fly   146 -LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
             |.:..::.|::||||:::|.: |.|...|.|......||.|||||.||...|..|.||:.::.|
Zfish   164 RLPSTCRKCYMLDFGLARQYTN-TNGEVRPPRSVAGFRGTVRYASINAHKNKEMGRHDDLWSLFY 227

  Fly   210 VLMYFNRGSLPWQDLKASTK----QQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYD 270
            :|:.|..|.|||:.:|...:    :::||.          .:|.:..|.||.::.::...:.::.
Zfish   228 MLVEFTVGQLPWRKIKDKEQVGQIKERYEH----------RMLLKHMPAEFHIFYDHVLDLDYFT 282

  Fly   271 KPNYDFICRMFRMLRNGLNLRPGLIYDWD------MLMMKFH-----NTQKNPGI--GMRVFP-- 320
            ||:|..:..:|........:.....|||:      .|....|     ||::...|  .:.|.|  
Zfish   283 KPDYQLLMSVFENSMKDRVITENEPYDWEKSGTDTALPTSTHTPPQQNTRQTAAIVGVVNVTPVP 347

  Fly   321 ---PKQKEDDGISGEPIIKDE 338
               |::..||.:..|.:...|
Zfish   348 GELPRENTDDVLQDEHLSDQE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 89/269 (33%)
SPS1 16..>242 CDD:223589 82/230 (36%)
ttbk1bXP_017207296.1 STKc_TTBK1 33..294 CDD:271032 89/270 (33%)
SPS1 34..393 CDD:223589 105/346 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.