powered by:
Protein Alignment Ten-a and bug-1
DIOPT Version :10
| Sequence 1: | NP_001162732.2 |
Gene: | Ten-a / 32183 |
FlyBaseID: | FBgn0267001 |
Length: | 3387 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001256538.1 |
Gene: | bug-1 / 179859 |
WormBaseID: | WBGene00011326 |
Length: | 3226 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 73 |
Identity: | 18/73 - (24%) |
| Similarity: | 22/73 - (30%) |
Gaps: | 28/73 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 185 KKVHERTGGAIGNFTEDEAEMLCHKDLQAIQDSIKGKYLFGDKITSADCTVFGEVASAYYPFPNK 249
|||.||..|. .|:.....||..| .|||....|..|| :
Worm 44 KKVMERVRGP---STDRVPSRLCQVD---------------------RCTVNLTEAKQYY----R 80
Fly 250 FSRIIDSH 257
..|:.:.|
Worm 81 RHRVCEVH 88
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.