DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ten-a and bug-1

DIOPT Version :10

Sequence 1:NP_001162732.2 Gene:Ten-a / 32183 FlyBaseID:FBgn0267001 Length:3387 Species:Drosophila melanogaster
Sequence 2:NP_001256538.1 Gene:bug-1 / 179859 WormBaseID:WBGene00011326 Length:3226 Species:Caenorhabditis elegans


Alignment Length:73 Identity:18/73 - (24%)
Similarity:22/73 - (30%) Gaps:28/73 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 KKVHERTGGAIGNFTEDEAEMLCHKDLQAIQDSIKGKYLFGDKITSADCTVFGEVASAYYPFPNK 249
            |||.||..|.   .|:.....||..|                     .|||....|..||    :
 Worm    44 KKVMERVRGP---STDRVPSRLCQVD---------------------RCTVNLTEAKQYY----R 80

  Fly   250 FSRIIDSH 257
            ..|:.:.|
 Worm    81 RHRVCEVH 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ten-aNP_001162732.2 acid_disulf_rpt 1199..1225 CDD:411265
NHL 1622..1927 CDD:302697
NHL repeat 1675..1721 CDD:271320
NHL repeat 1745..1787 CDD:271320
NHL repeat 1802..1847 CDD:271320
NHL repeat 1864..1897 CDD:271320
RHS_core <2118..>2248 CDD:469161
RhsA <2366..3015 CDD:442442
Tox-GHH 3272..3349 CDD:464783
EGF_2 937..960 CDD:400365
EGF_2 1003..1025 CDD:400365
EGF_2 1034..1057 CDD:400365
C_rich_MXAN6577 <1035..1146 CDD:469225
EGF_CA 1163..1192 CDD:238011
bug-1NP_001256538.1 Beta_helix 369..590 CDD:463811
Beta_helix 727..848 CDD:463811
Beta_helix 819..1005 CDD:463811
EGF_Tenascin 1113..1136 CDD:480934
EGF_2 1143..1166 CDD:400365
EGF_2 1175..1198 CDD:400365
DSL <1188..1230 CDD:473190
Cadherin_repeat 2692..2776 CDD:206637
DUF5585 2951..>3199 CDD:465521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.