DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB8 and Ubx

DIOPT Version :9

Sequence 1:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:277 Identity:91/277 - (32%)
Similarity:115/277 - (41%) Gaps:94/277 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    16 GESLRPNYYDC-------GFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNP 73
            |..:||:  .|       |:....||.|....|.|:||:                          
  Fly   150 GMPVRPS--ACTPDSRVGGYLDTSGGSPVSHRGGSAGGN-------------------------- 186

Human    74 CAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWM 138
              |:..|..||..|.     ||..|.........|:|.::.|:.....|....|:.:.| .:|||
  Fly   187 --VSVSGGNGNAGGV-----QSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT-FYPWM 243

Human   139 R--------------------------------PQAAAG------------RRRGRQTYSRYQTL 159
            .                                .::.||            ||||||||:|||||
  Fly   244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308

Human   160 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQ- 223
            ||||||..|.||||:||||::|||.|||||:||||||||||.|||....|      |..|.||| 
  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIK------ELNEQEKQA 367

Human   224 KLERAPEAADEGDAQKG 240
            :.::|..||....|.:|
  Fly   368 QAQKAAAAAAAAAAVQG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 2/4 (50%)
Homeobox 150..203 CDD:395001 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 13/39 (33%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.