Sequence 1: | NP_076921.1 | Gene: | HOXB8 / 3218 | HGNCID: | 5119 | Length: | 243 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477498.1 | Gene: | ftz / 40834 | FlyBaseID: | FBgn0001077 | Length: | 410 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 67/195 - (34%) |
---|---|---|---|
Similarity: | 89/195 - (45%) | Gaps: | 70/195 - (35%) |
- Green bases have known domain annotations that are detailed below.
Human 39 VYGPSSGGSFQHPSQIQEFYHG---------PSSL------STAPYQQNPCAVACHGDPGNFYGY 88
Human 89 DPLQRQSLFGAQDPDLV-QYADCKLAAA-SGLGEEAEGSEQSPSPTQLFPWMRPQAAAG-----R 146
Human 147 RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFP 211
Human 212 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXB8 | NP_076921.1 | Antp-type hexapeptide | 134..139 | 2/4 (50%) | |
Homeobox | 150..203 | CDD:395001 | 39/52 (75%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..243 | 3/9 (33%) | |||
ftz | NP_477498.1 | FTZ | 1..248 | CDD:281812 | 23/122 (19%) |
Homeobox | 257..310 | CDD:278475 | 39/52 (75%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |