DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB8 and zen2

DIOPT Version :9

Sequence 1:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:160 Identity:56/160 - (35%)
Similarity:71/160 - (44%) Gaps:40/160 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   103 DLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLF 167
            ||:.|...:|...:........||:|                  :|.|..:|..|.:|||:||..
  Fly    18 DLMMYPCVELNVEAAPTATTRSSEKS------------------KRSRTAFSSLQLIELEREFHL 64

Human   168 NPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK--------DKFPSSKCEQEELEKQ- 223
            |.||.|.||||:|..|.||||||||||||||||.||..|:        ...|.|....|:|:|. 
  Fly    65 NKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDD 129

Human   224 ------------KLERAP-EAADEGDAQKG 240
                        .:|.|| ...|.|..::|
  Fly   130 QIVERLLRYANTNVETAPLRQVDHGVLEEG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 13/60 (22%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.