DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and Arl2

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_006230961.1 Gene:Arl2 / 65142 RGDID:69326 Length:210 Species:Rattus norvegicus


Alignment Length:197 Identity:50/197 - (25%)
Similarity:86/197 - (43%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLTEVGGNVEMQR 94
            |.::|:||...:|||.:..:.:  ..|.|....|.|   :.:|:.|....:|.:.:|||...::.
  Rat    16 ELRLLMLGLDNAGKTTILKKFN--GEDVDTISPTLG---FNIKTLEHRGFKLNIWDVGGQKSLRS 75

  Fly    95 LWKHYYASSHALIYCFDLGADPMVMQG-----------------TFSLLTDC-----LVG----T 133
            .|::|:.|:..||:..| .||...||.                 |.|..|.|     |:|    .
  Rat    76 YWRNYFESTDGLIWVVD-SADRQRMQDCQRELQSLLVEEVCPVLTGSQATACHKCHGLLGHSGRE 139

  Fly   134 QLAGKPVLLVASRHRV--GVQLYDVEYAFGLEELAKSCDCPLLICHMDETEDLHRGIRWLCHQLM 196
            :|||..:|:.|::..:  .:....::.|..|:.: :|....:..|.....|||..||.||...:.
  Rat   140 RLAGATLLIFANKQDLPGALSCNAIQEALELDSI-RSHHWRIQGCSAVTGEDLLPGIDWLLDDIS 203

  Fly   197 AR 198
            :|
  Rat   204 SR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 22/80 (28%)
P-loop_NTPase 32..194 CDD:304359 48/189 (25%)
Arl2XP_006230961.1 Arl2 3..201 CDD:206720 49/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45697
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.