DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and SAR1B

DIOPT Version :10

Sequence 1:NP_572786.3 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_057187.1 Gene:SAR1B / 51128 HGNCID:10535 Length:198 Species:Homo sapiens


Alignment Length:184 Identity:44/184 - (23%)
Similarity:83/184 - (45%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLT--EVGGNVEMQR 94
            :::.||...:|||.|.|.|      :||:...: |......|.|..||.:..|  ::||:|:.:|
Human    27 KLVFLGLDNAGKTTLLHML------KDDRLGQH-VPTLHPTSEELTIAGMTFTTFDLGGHVQARR 84

  Fly    95 LWKHYYASSHALIYCFDLGADPMVMQG---TFSLLTDCLVGTQLAGKPVLLVAS----------- 145
            :||:|..:.:.:::..|......:::.   ..||:||    ..:|..|:|::.:           
Human    85 VWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTD----ETIANVPILILGNKIDRPEAISEE 145

  Fly   146 RHRVGVQLYDVEYAFG---LEEL-AKSCDCPLLICHMDETEDLHRGIRWLCHQL 195
            |.|....||......|   |:|| |:..:  :.:|.:.:.:....|.||:...:
Human   146 RLREMFGLYGQTTGKGSISLKELNARPLE--VFMCSVLKRQGYGEGFRWMAQYI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.3 P-loop containing Nucleoside Triphosphate Hydrolases 32..194 CDD:476819 44/181 (24%)
SAR1BNP_057187.1 Sar1 3..197 CDD:206645 44/182 (24%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.